Lineage for d3u01a_ (3u01 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635085Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1635454Protein automated matches [190061] (6 species)
    not a true protein
  7. 1635572Species Frog (Rana pipiens) [TaxId:8404] [188156] (4 PDB entries)
  8. 1635573Domain d3u01a_: 3u01 A: [186045]
    automated match to d1onca_
    complexed with act, so4; mutant

Details for d3u01a_

PDB Entry: 3u01 (more details), 1.12 Å

PDB Description: crystal structure of onconase double mutant c30a/c75a at 1.12 a resolution
PDB Compounds: (A:) Protein P-30

SCOPe Domain Sequences for d3u01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u01a_ d.5.1.1 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhakdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpakyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d3u01a_:

Click to download the PDB-style file with coordinates for d3u01a_.
(The format of our PDB-style files is described here.)

Timeline for d3u01a_: