SCOPe 2.01: Domain d3txya_: 3txy A:

Lineage for d3txya_ (3txy A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (6 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [189741] (1 PDB entry)

8. Domain d3txya_: 3txy A: [185998]
   automated match to d1j2ra_
   complexed with edo

Details for d3txya_

PDB Entry: 3txy, 1.7 Å

PDB Description: Structure of an Isochorismatase family protein (BTH_II2229) from Burkholderia thailandensis

PDB Compounds: (A:) Isochorismatase family protein family

SCOPe Domain Sequences for d3txya_:

Sequence; same for both SEQRES and ATOM records:

>d3txya_ c.33.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
siptlnptvalvaidlqngivvlpmvpqsggdvvaktaelanafrarklpvifvhtsyqp
dgavalkvktdvppsppnldpewsafapalgvqpldvvvtkhqwgaftgtdldvqlrrrg
itdivltgiatnigvestareayennynvvvvsdavstwstdaqtfaltqifpklgqvat
aadveaalet

Timeline for d3txya_:

• d3txya_ is new in SCOPe 2.01-stable
  
• d3txya_ appears in SCOPe 2.02
  
• d3txya_ appears in the current release, SCOPe 2.08