Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (6 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [189741] (1 PDB entry) |
Domain d3txya_: 3txy A: [185998] automated match to d1j2ra_ complexed with edo |
PDB Entry: 3txy (more details), 1.7 Å
SCOPe Domain Sequences for d3txya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3txya_ c.33.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]} siptlnptvalvaidlqngivvlpmvpqsggdvvaktaelanafrarklpvifvhtsyqp dgavalkvktdvppsppnldpewsafapalgvqpldvvvtkhqwgaftgtdldvqlrrrg itdivltgiatnigvestareayennynvvvvsdavstwstdaqtfaltqifpklgqvat aadveaalet
Timeline for d3txya_: