SCOPe 2.04: Domain d3ts5b_: 3ts5 B:

Lineage for d3ts5b_ (3ts5 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (20 species)
   not a true protein

7. Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)

8. Domain d3ts5b_: 3ts5 B: [185926]
   automated match to d1kk7y_
   complexed with ca, mg

Details for d3ts5b_

PDB Entry: 3ts5, 2.39 Å

PDB Description: Crystal Structure of a Light Chain Domain of Scallop Smooth Muscle Myosin

PDB Compounds: (B:) myosin regulatory light chain

SCOPe Domain Sequences for d3ts5b_:

Sequence; same for both SEQRES and ATOM records:

>d3ts5b_ a.39.1.5 (B:) automated matches {Placopecten magellanicus [TaxId: 6577]}
arlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnf
tmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtf
keapveggkfdyvrfvamikgs

Timeline for d3ts5b_:

• d3ts5b_ first appeared in SCOPe 2.01
  
• d3ts5b_ appears in SCOPe 2.03
  
• d3ts5b_ appears in SCOPe 2.05
  
• d3ts5b_ appears in the current release, SCOPe 2.08