Lineage for d1kk7y_ (1kk7 Y:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490242Protein Myosin Essential Chain [47524] (3 species)
  7. 1490243Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
    Uniprot P13543
  8. 1490252Domain d1kk7y_: 1kk7 Y: [77426]
    Other proteins in same PDB: d1kk7a1, d1kk7a2, d1kk7z_
    complexed with ca, mg, so4

Details for d1kk7y_

PDB Entry: 1kk7 (more details), 3.2 Å

PDB Description: scallop myosin in the near rigor conformation
PDB Compounds: (Y:) myosin regulatory light chain, striated adductor muscle

SCOPe Domain Sequences for d1kk7y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk7y_ a.39.1.5 (Y:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
klpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnft
mflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfk
eapveggkfdyvkftamikgsgee

SCOPe Domain Coordinates for d1kk7y_:

Click to download the PDB-style file with coordinates for d1kk7y_.
(The format of our PDB-style files is described here.)

Timeline for d1kk7y_: