Class b: All beta proteins [48724] (174 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (5 species) not a true protein |
Species Influenza A virus [TaxId:641501] [189475] (5 PDB entries) |
Domain d3ti5a_: 3ti5 A: [185851] automated match to d1a14n_ complexed with act, ca, gol, nag, zmr |
PDB Entry: 3ti5 (more details), 1.9 Å
SCOPe Domain Sequences for d3ti5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ti5a_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 641501]} svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs sisfcgvnsdtvgwswpdgaelpftid
Timeline for d3ti5a_: