Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (14 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries) |
Domain d3ta2b_: 3ta2 B: [185736] automated match to d1qy7a_ complexed with akg, atp, mg, ni |
PDB Entry: 3ta2 (more details), 1.9 Å
SCOPe Domain Sequences for d3ta2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ta2b_ d.58.5.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev
Timeline for d3ta2b_: