Lineage for d1c3oa1 (1c3o A:403-555)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215860Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 215861Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 215862Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 215863Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 215864Species Escherichia coli [TaxId:562] [48111] (9 PDB entries)
  8. 215881Domain d1c3oa1: 1c3o A:403-555 [18562]
    Other proteins in same PDB: d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2

Details for d1c3oa1

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3oa1 a.92.1.1 (A:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1c3oa1:

Click to download the PDB-style file with coordinates for d1c3oa1.
(The format of our PDB-style files is described here.)

Timeline for d1c3oa1: