Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) |
Protein Clp protease, ClpP subunit [52098] (8 species) |
Species Staphylococcus aureus [TaxId:196620] [189881] (2 PDB entries) |
Domain d3st9c_: 3st9 C: [185526] automated match to d1tyfa_ complexed with ca, gol, so4 |
PDB Entry: 3st9 (more details), 2.43 Å
SCOPe Domain Sequences for d3st9c_:
Sequence, based on SEQRES records: (download)
>d3st9c_ c.14.1.1 (C:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]} ydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfai ydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqateie iaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
>d3st9c_ c.14.1.1 (C:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]} ydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfai ydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqpqgqateieiaan hilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
Timeline for d3st9c_: