Lineage for d3st3c_ (3st3 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199443Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (35 PDB entries)
  8. 1199469Domain d3st3c_: 3st3 C: [185518]
    automated match to d1huya_
    complexed with po4

Details for d3st3c_

PDB Entry: 3st3 (more details), 1.7 Å

PDB Description: dreiklang - off state
PDB Compounds: (C:) Dreiklang

SCOPe Domain Sequences for d3st3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3st3c_ d.22.1.1 (C:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt
tixlmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhyqq
ntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmd

SCOPe Domain Coordinates for d3st3c_:

Click to download the PDB-style file with coordinates for d3st3c_.
(The format of our PDB-style files is described here.)

Timeline for d3st3c_: