Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (22 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries) |
Domain d3st2c1: 3st2 C:3-231 [185515] Other proteins in same PDB: d3st2a2, d3st2c2 automated match to d1huya_ complexed with po4 |
PDB Entry: 3st2 (more details), 1.9 Å
SCOPe Domain Sequences for d3st2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3st2c1 d.22.1.1 (C:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt tigyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr ielkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhy qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitl
Timeline for d3st2c1: