Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Human enterovirus 71 [TaxId:39054] [189720] (3 PDB entries) |
Domain d3sjod_: 3sjo D: [185431] automated match to d1l1na_ complexed with ag7 |
PDB Entry: 3sjo (more details), 1.7 Å
SCOPe Domain Sequences for d3sjod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sjod_ b.47.1.4 (D:) 3C cysteine protease (picornain 3C) {Human enterovirus 71 [TaxId: 39054]} ldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldavelv deqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvvqyg flnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfase
Timeline for d3sjod_: