Lineage for d3sc6c_ (3sc6 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830631Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries)
  8. 1830634Domain d3sc6c_: 3sc6 C: [185354]
    automated match to d1vl0b_
    complexed with nap, so4

Details for d3sc6c_

PDB Entry: 3sc6 (more details), 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp
PDB Compounds: (C:) dTDP-4-dehydrorhamnose reductase

SCOPe Domain Sequences for d3sc6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sc6c_ c.2.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 198094]}
mkerviitgangqlgkqlqeelnpeeydiypfdkkllditnisqvqqvvqeirphiiihc
aaytkvdqaekerdlayvinaigarnvavasqlvgaklvyistdyvfqgdrpegydefhn
papiniygaskyageqfvkelhnkyfivrtswlygkygnnfvktmirlgkereeisvvad
qigsptyvadlnvminklihtslygtyhvsntgscswfefakkifsyanmkvnvlpvste
efgaaaarpkysifqhnmlrlngflqmpsweeglerffiet

SCOPe Domain Coordinates for d3sc6c_:

Click to download the PDB-style file with coordinates for d3sc6c_.
(The format of our PDB-style files is described here.)

Timeline for d3sc6c_: