Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
Protein automated matches [190062] (6 species) not a true protein |
Species Herbaspirillum seropedicae [TaxId:757424] [189857] (1 PDB entry) |
Domain d3sb2d_: 3sb2 D: [185331] automated match to d1hk9d_ complexed with gol |
PDB Entry: 3sb2 (more details), 2.63 Å
SCOPe Domain Sequences for d3sb2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sb2d_ b.38.1.2 (D:) automated matches {Herbaspirillum seropedicae [TaxId: 757424]} qllqdpflnalrkehvpvsiylvngiklqghvesfdqyvvllrntvtqmvykhaistvvp aravnl
Timeline for d3sb2d_: