Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.7: Satellite viruses [88650] (1 family) |
Family b.121.7.1: Satellite viruses [88651] (3 proteins) |
Protein STNV coat protein [49621] (1 species) |
Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (3 PDB entries) |
Domain d3rqvl_: 3rqv L: [185110] automated match to d2buka1 complexed with ca |
PDB Entry: 3rqv (more details), 1.45 Å
SCOPe Domain Sequences for d3rqvl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rqvl_ b.121.7.1 (L:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]} tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav ytda
Timeline for d3rqvl_: