SCOPe 2.08: Domain d3rmub1: 3rmu B:45-176

Lineage for d3rmub1 (3rmu B:45-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189952] (2 PDB entries)

8. Domain d3rmub1: 3rmu B:45-176 [185031]
   Other proteins in same PDB: d3rmua2, d3rmub2, d3rmuc2, d3rmud2
   automated match to d1jc4a_
   complexed with co, edo, pg4

Details for d3rmub1

PDB Entry: 3rmu, 1.8 Å

PDB Description: Crystal structure of human Methylmalonyl-CoA epimerase, MCEE

PDB Compounds: (B:) Methylmalonyl-CoA epimerase, mitochondrial

SCOPe Domain Sequences for d3rmub1:

Sequence; same for both SEQRES and ATOM records:

>d3rmub1 d.32.1.0 (B:45-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgrlnhvaiavpdlekaaafyknilgaqvseavplpehgvsvvfvnlgntkmellhplgl
dspiagflqknkaggmhhicievdninaavmdlkkkkirslseevkigahgkpviflhpk
dcggvlveleqa

Timeline for d3rmub1:

• d3rmub1 first appeared in SCOPe 2.01, called d3rmub_
  
• d3rmub1 appears in SCOPe 2.07