Lineage for d3rhib1 (3rhi B:1-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715189Protein automated matches [190320] (2 species)
    not a true protein
  7. 2715190Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry)
  8. 2715192Domain d3rhib1: 3rhi B:1-90 [184965]
    Other proteins in same PDB: d3rhib2
    automated match to d1huea_

Details for d3rhib1

PDB Entry: 3rhi (more details), 2.48 Å

PDB Description: dna-binding protein hu from bacillus anthracis
PDB Compounds: (B:) DNA-binding protein HU

SCOPe Domain Sequences for d3rhib1:

Sequence, based on SEQRES records: (download)

>d3rhib1 a.55.1.1 (B:1-90) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg
rnpqtgeemqiaaskvpafkagkelkeavk

Sequence, based on observed residues (ATOM records): (download)

>d3rhib1 a.55.1.1 (B:1-90) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg
qtgeemqiaaskvpafkagkelkeavk

SCOPe Domain Coordinates for d3rhib1:

Click to download the PDB-style file with coordinates for d3rhib1.
(The format of our PDB-style files is described here.)

Timeline for d3rhib1: