SCOPe 2.01: Domain d3rggd_: 3rgg D:

Lineage for d3rggd_ (3rgg D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.0: automated matches [191522] (1 protein)
   not a true family

6. Protein automated matches [190879] (3 species)
   not a true protein

7. Species Treponema denticola [TaxId:158] [189960] (2 PDB entries)

8. Domain d3rggd_: 3rgg D: [184949]
   automated match to d1o4va_
   complexed with air

Details for d3rggd_

PDB Entry: 3rgg, 1.82 Å

PDB Description: Crystal structure of Treponema denticola PurE bound to AIR

PDB Compounds: (D:) Phosphoribosylaminoimidazole carboxylase, PurE protein

SCOPe Domain Sequences for d3rggd_:

Sequence; same for both SEQRES and ATOM records:

>d3rggd_ c.23.8.0 (D:) automated matches {Treponema denticola [TaxId: 158]}
mrplviilmgsssdmghaekiaselktfgieyairigsahktaehvvsmlkeyealdrpk
lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
allaarifslydkeiadsvksymesnaqkiieddsk

Timeline for d3rggd_:

• d3rggd_ is new in SCOPe 2.01-stable
  
• d3rggd_ appears in SCOPe 2.02
  
• d3rggd_ appears in the current release, SCOPe 2.08