SCOP 1.63: Domain d1nol_1: 1nol 1-109

Lineage for d1nol_1 (1nol 1-109)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
   6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)
   Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries)

8. Domain d1nol_1: 1nol 1-109 [18487]
   Other proteins in same PDB: d1nol_2, d1nol_3
   complexed with ca, cu, no3, per

Details for d1nol_1

PDB Entry: 1nol, 2.4 Å

PDB Description: oxygenated hemocyanin (subunit type ii)

SCOP Domain Sequences for d1nol_1:

Sequence, based on SEQRES records:

>d1nol_1 a.85.1.1 (1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)}
tlhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp

Sequence, based on observed residues (ATOM records):

>d1nol_1 a.85.1.1 (1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)}
tlhdkqirichlfeqlssatvhsdrlknvgklqpgaifscfhpdhleearhlyevfweag
dfndfieiakeartfvneglfafaaevavlhrddckglyvp

Timeline for d1nol_1:

• d1nol_1 first appeared (with stable ids) in SCOP 1.55
  
• d1nol_1 appears in SCOP 1.61
  
• d1nol_1 appears in SCOP 1.65
  
• d1nol_1 appears in the current release, SCOPe 2.08, called d1nola1