SCOPe 2.01: Domain d3r68a_: 3r68 A:

Lineage for d3r68a_ (3r68 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189959] (3 PDB entries)

8. Domain d3r68a_: 3r68 A: [184814]
   automated match to d1g9oa_
   complexed with act, ca, cl, edo, zn

Details for d3r68a_

PDB Entry: 3r68, 1.3 Å

PDB Description: Molecular Analysis of the PDZ3 domain of PDZK1

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF3

SCOPe Domain Sequences for d3r68a_:

Sequence, based on SEQRES records:

>d3r68a_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sphqprvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngksv
ealdhdgvvemirkggdqttllvldke

Sequence, based on observed residues (ATOM records):

>d3r68a_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sphqprvvvikkgsngygfylragqkgqiikdiepgspaeaaglknndlvvavngksvea
ldhdgvvemirkggdqttllvldke

Timeline for d3r68a_:

• d3r68a_ is new in SCOPe 2.01-stable
  
• d3r68a_ appears in SCOPe 2.02
  
• d3r68a_ appears in the current release, SCOPe 2.08, called d3r68a1