Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (3 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
Protein automated matches [190935] (4 species) not a true protein |
Species uncultured organism [TaxId:155900] [189680] (1 PDB entry) |
Domain d3r0pa_: 3r0p A: [184760] automated match to d1qd9a_ |
PDB Entry: 3r0p (more details), 1.9 Å
SCOPe Domain Sequences for d3r0pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r0pa_ d.79.1.0 (A:) automated matches {uncultured organism [TaxId: 155900]} nkaiihsdnapaaigtysqavkvnntvylsgqipldpvtmqlvegdfavqahqvfknlra vceaaggglrdivklnvyltdlanfpivnevmgqyfqapyparaaiginqlprasliead gimvi
Timeline for d3r0pa_: