SCOPe 2.08: Domain d3qmnp1: 3qmn P:1-125

Lineage for d3qmnp1 (3qmn P:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (11 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189656] (3 PDB entries)

8. Domain d3qmnp1: 3qmn P:1-125 [184515]
   Other proteins in same PDB: d3qmna2, d3qmnb2, d3qmnc2, d3qmnd2, d3qmne2, d3qmnf2, d3qmng2, d3qmnh2, d3qmni2, d3qmnj2, d3qmnk2, d3qmnl2, d3qmnm2, d3qmnn2, d3qmno2, d3qmnp2, d3qmnq2, d3qmnr2, d3qmnt2, d3qmnu2, d3qmnv2
   automated match to d1f7la_
   complexed with a3p, act, ca, cl, coa, mpd, mrd

Details for d3qmnp1

PDB Entry: 3qmn, 1.85 Å

PDB Description: Crystal Structure of 4'-Phosphopantetheinyl Transferase AcpS from Vibrio cholerae O1 biovar eltor

PDB Compounds: (P:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3qmnp1:

Sequence; same for both SEQRES and ATOM records:

>d3qmnp1 d.150.1.0 (P:1-125) automated matches {Vibrio cholerae [TaxId: 243277]}
mivglgtdiaeiervekalarsgenfarriltdseleqfhaskqqgrflakrfaakeaas
kalgtgiaqgvtfhdftishdklgkpllilsgqaaelasqlqvenihlsisderhyamat
viler

Timeline for d3qmnp1:

• d3qmnp1 first appeared in SCOPe 2.01, called d3qmnp_
  
• d3qmnp1 appears in SCOPe 2.07