Lineage for d3qjnh_ (3qjn H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948108Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 948307Protein Shank1, PDZ domain [101733] (1 species)
    SH3 and multiple ankyrin repeat domains protein 1
  7. 948308Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (4 PDB entries)
  8. 948322Domain d3qjnh_: 3qjn H: [184450]
    automated match to d1q3ob_

Details for d3qjnh_

PDB Entry: 3qjn (more details), 2.71 Å

PDB Description: Structural flexibility of Shank PDZ domain is important for its binding to different ligands
PDB Compounds: (H:) SH3 and multiple ankyrin repeat domains protein 1

SCOPe Domain Sequences for d3qjnh_:

Sequence, based on SEQRES records: (download)

>d3qjnh_ b.36.1.1 (H:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

Sequence, based on observed residues (ATOM records): (download)

>d3qjnh_ b.36.1.1 (H:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrmgd
flievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

SCOPe Domain Coordinates for d3qjnh_:

Click to download the PDB-style file with coordinates for d3qjnh_.
(The format of our PDB-style files is described here.)

Timeline for d3qjnh_: