Lineage for d3qjma_ (3qjm A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122539Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1122738Protein Shank1, PDZ domain [101733] (1 species)
    SH3 and multiple ankyrin repeat domains protein 1
  7. 1122739Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (4 PDB entries)
  8. 1122742Domain d3qjma_: 3qjm A: [184441]
    automated match to d1q3ob_

Details for d3qjma_

PDB Entry: 3qjm (more details), 2.31 Å

PDB Description: Structural flexibility of Shank PDZ domain is important for its binding to different ligands
PDB Compounds: (A:) SH3 and multiple ankyrin repeat domains protein 1

SCOPe Domain Sequences for d3qjma_:

Sequence, based on SEQRES records: (download)

>d3qjma_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

Sequence, based on observed residues (ATOM records): (download)

>d3qjma_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrmgd
flievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

SCOPe Domain Coordinates for d3qjma_:

Click to download the PDB-style file with coordinates for d3qjma_.
(The format of our PDB-style files is described here.)

Timeline for d3qjma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3qjmb_