SCOPe 2.02: Domain d3qihb_: 3qih B:

Lineage for d3qihb_ (3qih B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3qihb_: 3qih B: [184404]
   automated match to d1a30a_
   complexed with cl, fg7, ni7, pge; mutant

Details for d3qihb_

PDB Entry: 3qih, 1.39 Å

PDB Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a novel inhibitor

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3qihb_:

Sequence; same for both SEQRES and ATOM records:

>d3qihb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3qihb_:

• d3qihb_ first appeared in SCOPe 2.01
  
• d3qihb_ appears in SCOPe 2.03
  
• d3qihb_ appears in the current release, SCOPe 2.08