Lineage for d3qcab_ (3qca B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018081Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 1018101Protein automated matches [191298] (1 species)
    not a true protein
  7. 1018102Species Human (Homo sapiens) [TaxId:9606] [189969] (2 PDB entries)
  8. 1018105Domain d3qcab_: 3qca B: [184336]
    automated match to d1h8ca_

Details for d3qcab_

PDB Entry: 3qca (more details), 2.9 Å

PDB Description: Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The Conserved FcisP Touch-Turn Motif of UBX Domain Suffering Conformational Change
PDB Compounds: (B:) fas-associated factor 1

SCOPe Domain Sequences for d3qcab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qcab_ d.15.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
ksllevklfpqetlfleake

SCOPe Domain Coordinates for d3qcab_:

Click to download the PDB-style file with coordinates for d3qcab_.
(The format of our PDB-style files is described here.)

Timeline for d3qcab_: