Lineage for d3q32a_ (3q32 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1044054Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1044055Protein automated matches [190417] (3 species)
    not a true protein
  7. 1044070Species Human (Homo sapiens) [TaxId:9606] [187294] (40 PDB entries)
  8. 1044103Domain d3q32a_: 3q32 A: [184178]
    automated match to d1u46a_
    complexed with j2i

Details for d3q32a_

PDB Entry: 3q32 (more details), 2.5 Å

PDB Description: Structure of Janus kinase 2 with a pyrrolotriazine inhibitor
PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d3q32a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q32a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag

SCOPe Domain Coordinates for d3q32a_:

Click to download the PDB-style file with coordinates for d3q32a_.
(The format of our PDB-style files is described here.)

Timeline for d3q32a_: