Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (20 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187022] (5 PDB entries) |
Domain d3q0jf_: 3q0j F: [184119] automated match to d1duba_ complexed with caa |
PDB Entry: 3q0j (more details), 2.4 Å
SCOPe Domain Sequences for d3q0jf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0jf_ c.14.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli aadtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs egmaafiekrapqf
Timeline for d3q0jf_: