Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries) |
Domain d3pxxc1: 3pxx C:1-283 [184074] Other proteins in same PDB: d3pxxa2, d3pxxc2, d3pxxf2 automated match to d1dohb_ complexed with nad |
PDB Entry: 3pxx (more details), 2 Å
SCOPe Domain Sequences for d3pxxc1:
Sequence, based on SEQRES records: (download)
>d3pxxc1 c.2.1.0 (C:1-283) automated matches {Mycobacterium avium [TaxId: 243243]} mgrvqdkvvlvtggargqgrshavklaeegadiilfdichdietneyplatsrdleeagl evektgrkaytaevdvrdraavsrelanavaefgkldvvvanagicplgahlpvqafada fdvdfvgvintvhaalpyltsgasiittgsvagliaaaqppgaggpqgpggagysyakql vdsytlqlaaqlapqsiranvihptnvntdmlnsapmyrqfrpdleapsradallafpam qamptpyveasdisnavcflasdesryvtglqfkvdagamlkf
>d3pxxc1 c.2.1.0 (C:1-283) automated matches {Mycobacterium avium [TaxId: 243243]} mgrvqdkvvlvtggargqgrshavklaeegadiilfdichdietneyplatsrdleeagl evektgrkaytaevdvrdraavsrelanavaefgkldvvvanagicplgahlpvqafada fdvdfvgvintvhaalpyltsgasiittgsvagliapqgpggagysyakqlvdsytlqla aqlapqsiranvihptnvntdmlnsapmyrqfrpdleapsradallafpamqamptpyve asdisnavcflasdesryvtglqfkvdagamlkf
Timeline for d3pxxc1: