Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (13 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (29 PDB entries) |
Domain d3pvub_: 3pvu B: [184019] Other proteins in same PDB: d3pvua1, d3pvua2, d3pvua3, d3pvug_ automated match to d1b9xa_ complexed with qrw |
PDB Entry: 3pvu (more details), 2.48 Å
SCOPe Domain Sequences for d3pvub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvub_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam hwgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d3pvub_:
View in 3D Domains from other chains: (mouse over for more information) d3pvua1, d3pvua2, d3pvua3, d3pvug_ |