SCOPe 2.02: Domain d3puve_: 3puv E:

Lineage for d3puve_ (3puv E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries)

8. Domain d3puve_: 3puv E: [183982]
   Other proteins in same PDB: d3puvg_
   automated match to d1anfa_
   complexed with adp, mal, mg, pgv, umq, vo4

Details for d3puve_

PDB Entry: 3puv, 2.4 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4

PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3puve_:

Sequence; same for both SEQRES and ATOM records:

>d3puve_ c.94.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritkasas

Timeline for d3puve_:

• d3puve_ first appeared in SCOPe 2.01
  
• d3puve_ appears in SCOPe 2.03
  
• d3puve_ appears in the current release, SCOPe 2.08, called d3puve1