SCOPe 2.07: Domain d1d3ub1: 1d3u B:1100-1205

Lineage for d1d3ub1 (1d3u B:1100-1205)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Pyrococcus woesei [TaxId:2262] [47968] (2 PDB entries)

8. Domain d1d3ub1: 1d3u B:1100-1205 [18386]
   Other proteins in same PDB: d1d3ua1, d1d3ua2
   protein/DNA complex

Details for d1d3ub1

PDB Entry: 1d3u, 2.4 Å

PDB Description: tata-binding protein/transcription factor (ii)b/bre+tata-box complex from pyrococcus woesei

PDB Compounds: (B:) transcription initiation factor iib

SCOPe Domain Sequences for d1d3ub1:

Sequence; same for both SEQRES and ATOM records:

>d1d3ub1 a.74.1.2 (B:1100-1205) Transcription factor IIB (TFIIB), core domain {Pyrococcus woesei [TaxId: 2262]}
mvsdaaernlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacv
yaacrllkvprtldeiadiarvdkkeigrsyrfiarnlnltpkklf

Timeline for d1d3ub1:

• d1d3ub1 first appeared (with stable ids) in SCOP 1.55
  
• d1d3ub1 appears in SCOPe 2.06
  
• d1d3ub1 appears in the current release, SCOPe 2.08