SCOPe 2.06: Domain d3pjbb_: 3pjb B:

Lineage for d3pjbb_ (3pjb B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)

8. Domain d3pjbb_: 3pjb B: [183797]
   automated match to d1uisa_
   complexed with gol

Details for d3pjbb_

PDB Entry: 3pjb, 1.75 Å

PDB Description: crystal structure of red fluorescent protein eqfp578 crystallized at ph 4.0

PDB Compounds: (B:) Red fluorescent protein eqFP578

SCOPe Domain Sequences for d3pjbb_:

Sequence; same for both SEQRES and ATOM records:

>d3pjbb_ d.22.1.1 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
selikenmhmklymegtvnnhhfkctsegegkpyegtqtmkikvveggplpfafdilats
fmygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqngciiynvki
ngvnfpsngsvmqkktlgweantemlypadgglrghsqmalklvgggylhcsfkttyrsk
kpaknlkmpgfhfvdhrlerikeadketyveqhemavakycdlps

Timeline for d3pjbb_:

• d3pjbb_ first appeared in SCOPe 2.01
  
• d3pjbb_ appears in SCOPe 2.05
  
• d3pjbb_ appears in SCOPe 2.07
  
• d3pjbb_ appears in the current release, SCOPe 2.08