![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (10 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [189538] (1 PDB entry) |
![]() | Domain d3pj9b_: 3pj9 B: [183793] automated match to d1nhkr_ complexed with so4 |
PDB Entry: 3pj9 (more details), 2.1 Å
SCOPe Domain Sequences for d3pj9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pj9b_ d.58.6.1 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]} mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpffkd lvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsl enakieiefffkpneic
Timeline for d3pj9b_: