Lineage for d3pi8a_ (3pi8 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716111Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)
  8. 1716126Domain d3pi8a_: 3pi8 A: [183759]
    Other proteins in same PDB: d3pi8b_, d3pi8d_
    automated match to d1fsxa_
    complexed with cmo, hem

Details for d3pi8a_

PDB Entry: 3pi8 (more details), 2.2 Å

PDB Description: Site-specific Glycosylation of Hemoglobin Utilizing Oxime Ligation Chemistry as a Viable Alternative to PEGylation
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3pi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pi8a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d3pi8a_:

Click to download the PDB-style file with coordinates for d3pi8a_.
(The format of our PDB-style files is described here.)

Timeline for d3pi8a_: