Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein automated matches [190083] (7 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186804] (3 PDB entries) |
Domain d3pg9c_: 3pg9 C: [183707] automated match to d1rzma_ complexed with azi, cl, no3, tyr |
PDB Entry: 3pg9 (more details), 2.35 Å
SCOPe Domain Sequences for d3pg9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pg9c_ c.1.10.4 (C:) automated matches {Thermotoga maritima [TaxId: 2336]} mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh pepekalsdgkqsldfelfkelvqemkkladalgvkvn
Timeline for d3pg9c_: