Lineage for d3p95a_ (3p95 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953999Protein Trypsin(ogen) [50515] (9 species)
  7. 954393Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (6 PDB entries)
  8. 954394Domain d3p95a_: 3p95 A: [183599]
    Other proteins in same PDB: d3p95e_
    automated match to d1h4wa_
    complexed with ca

Details for d3p95a_

PDB Entry: 3p95 (more details), 1.3 Å

PDB Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17D)
PDB Compounds: (A:) PRSS3 protein

SCOPe Domain Sequences for d3p95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p95a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d3p95a_:

Click to download the PDB-style file with coordinates for d3p95a_.
(The format of our PDB-style files is described here.)

Timeline for d3p95a_: