SCOPe 2.02: Domain d3otje_: 3otj E:

Lineage for d3otje_ (3otj E:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d3otje_: 3otj E: [183281]
   Other proteins in same PDB: d3otji_
   automated match to d1aq7a_
   complexed with ca, dod, so4

Details for d3otje_

PDB Entry: 3otj, 2.15 Å

PDB Description: a crystal structure of trypsin complexed with bpti (bovine pancreatic trypsin inhibitor) by x-ray/neutron joint refinement

PDB Compounds: (E:) cationic trypsin

SCOPe Domain Sequences for d3otje_:

Sequence; same for both SEQRES and ATOM records:

>d3otje_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3otje_:

• d3otje_ first appeared in SCOPe 2.01
  
• d3otje_ appears in SCOPe 2.03
  
• d3otje_ appears in the current release, SCOPe 2.08