SCOP 1.63: Domain d1ak4c_: 1ak4 C:

Lineage for d1ak4c_ (1ak4 C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (8 PDB entries)

8. Domain d1ak4c_: 1ak4 C: [18321]
   Other proteins in same PDB: d1ak4a_, d1ak4b_

Details for d1ak4c_

PDB Entry: 1ak4, 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid

SCOP Domain Sequences for d1ak4c_:

Sequence; same for both SEQRES and ATOM records:

>d1ak4c_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Timeline for d1ak4c_:

• d1ak4c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ak4c_ appears in SCOP 1.61
  
• d1ak4c_ appears in SCOP 1.65
  
• d1ak4c_ appears in the current release, SCOPe 2.08