Lineage for d3ol9e_ (3ol9 E:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1693058Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1693066Protein Viral RNA polymerase [56695] (17 species)
  7. 1693314Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
    Uniprot P03300 1748-2208
  8. 1693317Domain d3ol9e_: 3ol9 E: [183123]
    automated match to d1ra6a_
    protein/RNA complex; complexed with ipa, pop, zn

Details for d3ol9e_

PDB Entry: 3ol9 (more details), 2.25 Å

PDB Description: poliovirus polymerase elongation complex with 3'-deoxy-ctp
PDB Compounds: (E:) Polymerase

SCOPe Domain Sequences for d3ol9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ol9e_ e.8.1.4 (E:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlyrrwldsf

SCOPe Domain Coordinates for d3ol9e_:

Click to download the PDB-style file with coordinates for d3ol9e_.
(The format of our PDB-style files is described here.)

Timeline for d3ol9e_: