![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
![]() | Domain d3o9ha_: 3o9h A: [182892] automated match to d1kzka_ complexed with act, k2e, po4 |
PDB Entry: 3o9h (more details), 1.7 Å
SCOPe Domain Sequences for d3o9ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9ha_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3o9ha_: