Lineage for d3o9ha_ (3o9h A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 956189Protein automated matches [190433] (10 species)
    not a true protein
  7. 956217Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries)
  8. 956235Domain d3o9ha_: 3o9h A: [182892]
    automated match to d1kzka_
    complexed with act, k2e, po4

Details for d3o9ha_

PDB Entry: 3o9h (more details), 1.7 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with kd26
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3o9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9ha_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3o9ha_:

Click to download the PDB-style file with coordinates for d3o9ha_.
(The format of our PDB-style files is described here.)

Timeline for d3o9ha_: