![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein automated matches [190433] (10 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries) |
![]() | Domain d3o9ga_: 3o9g A: [182890] automated match to d1kzka_ complexed with f53, po4 |
PDB Entry: 3o9g (more details), 1.65 Å
SCOPe Domain Sequences for d3o9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9ga_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3o9ga_: