Lineage for d3o6oa1 (3o6o A:1-208)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2580057Protein automated matches [190229] (13 species)
    not a true protein
  7. 2580319Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries)
  8. 2580320Domain d3o6oa1: 3o6o A:1-208 [182839]
    Other proteins in same PDB: d3o6oa2
    automated match to d1uy6a_
    complexed with 1pe, 94m

Details for d3o6oa1

PDB Entry: 3o6o (more details), 2 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of an the inhibitor biib021
PDB Compounds: (A:) Heat shock protein 83

SCOPe Domain Sequences for d3o6oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6oa1 d.122.1.1 (A:1-208) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielmve

SCOPe Domain Coordinates for d3o6oa1:

Click to download the PDB-style file with coordinates for d3o6oa1.
(The format of our PDB-style files is described here.)

Timeline for d3o6oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o6oa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3o6ob_