SCOPe 2.06: Domain d3o6oa1: 3o6o A:1-208

Lineage for d3o6oa1 (3o6o A:1-208)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (11 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries)

8. Domain d3o6oa1: 3o6o A:1-208 [182839]
   Other proteins in same PDB: d3o6oa2
   automated match to d1uy6a_
   complexed with 1pe, 94m

Details for d3o6oa1

PDB Entry: 3o6o, 2 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of an the inhibitor biib021

PDB Compounds: (A:) Heat shock protein 83

SCOPe Domain Sequences for d3o6oa1:

Sequence; same for both SEQRES and ATOM records:

>d3o6oa1 d.122.1.1 (A:1-208) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielmve

Timeline for d3o6oa1:

• d3o6oa1 first appeared in SCOPe 2.01, called d3o6oa_
  
• d3o6oa1 was called d3o6oa_ in SCOPe 2.05
  
• d3o6oa1 appears in SCOPe 2.07
  
• d3o6oa1 appears in the current release, SCOPe 2.08