Lineage for d3nuja_ (3nuj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1130029Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1130045Protein Human immunodeficiency virus type 1 protease [50632] (7 species)
  7. 1130131Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1130283Domain d3nuja_: 3nuj A: [182562]
    automated match to d1fgcc_
    complexed with 478, iod; mutant

Details for d3nuja_

PDB Entry: 3nuj (more details), 1.5 Å

PDB Description: Crystal Structure of HIV-1 Protease Mutant I54V with Antiviral Drug Amprenavir
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3nuja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nuja_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfvkvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3nuja_:

Click to download the PDB-style file with coordinates for d3nuja_.
(The format of our PDB-style files is described here.)

Timeline for d3nuja_: