SCOPe 2.04: Domain d3nt9b_: 3nt9 B:

Lineage for d3nt9b_ (3nt9 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)

8. Domain d3nt9b_: 3nt9 B: [182534]
   automated match to d1uisa_

Details for d3nt9b_

PDB Entry: 3nt9, 1.99 Å

PDB Description: crystal structure of lssmkate1 red fluorescent proteins with large stokes shift

PDB Compounds: (B:) LSSmKate1 red fluorescent protein

SCOPe Domain Sequences for d3nt9b_:

Sequence; same for both SEQRES and ATOM records:

>d3nt9b_ d.22.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl

Timeline for d3nt9b_:

• d3nt9b_ first appeared in SCOPe 2.01
  
• d3nt9b_ appears in SCOPe 2.03
  
• d3nt9b_ appears in SCOPe 2.05
  
• d3nt9b_ appears in the current release, SCOPe 2.08