Lineage for d1uisa_ (1uis A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643573Protein Red fluorescent protein fp61 [102854] (1 species)
  7. 1643574Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry)
  8. 1643575Domain d1uisa_: 1uis A: [99431]
    complexed with acy, ca

Details for d1uisa_

PDB Entry: 1uis (more details), 2 Å

PDB Description: The 2.0 crystal structure of eqFP611, a far-red fluorescent protein from the sea anemone Entacmaea quadricolor
PDB Compounds: (A:) red fluorescent protein FP611

SCOPe Domain Sequences for d1uisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uisa_ d.22.1.1 (A:) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
ihmnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdil
atsfmygsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyh
akvtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfetty
rskktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp

SCOPe Domain Coordinates for d1uisa_:

Click to download the PDB-style file with coordinates for d1uisa_.
(The format of our PDB-style files is described here.)

Timeline for d1uisa_: