Lineage for d3noaa_ (3noa A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502431Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1502432Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1502433Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (85 PDB entries)
    Uniprot P37231 232-505
  8. 1502894Domain d3noaa_: 3noa A: [182438]
    automated match to d1fm6d_
    complexed with 5bc

Details for d3noaa_

PDB Entry: 3noa (more details), 1.98 Å

PDB Description: Crystal structure of human PPAR-gamma ligand binding domain complex with a potency improved agonist
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3noaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3noaa_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d3noaa_:

Click to download the PDB-style file with coordinates for d3noaa_.
(The format of our PDB-style files is described here.)

Timeline for d3noaa_: