Lineage for d1cjuc1 (1cju C:86-201)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739075Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1739076Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1739077Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1739078Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1739079Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 1739093Domain d1cjuc1: 1cju C:86-201 [18207]
    Other proteins in same PDB: d1cjua_, d1cjub_, d1cjuc2
    complexed with cl, dad, fok, gsp, mg

Details for d1cjuc1

PDB Entry: 1cju (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg
PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cjuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjuc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d1cjuc1:

Click to download the PDB-style file with coordinates for d1cjuc1.
(The format of our PDB-style files is described here.)

Timeline for d1cjuc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjuc2