![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein automated matches [190060] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) |
![]() | Domain d3n2nc1: 3n2n C:38-220 [181841] Other proteins in same PDB: d3n2na2, d3n2nb2, d3n2nc2, d3n2nd2, d3n2ne2, d3n2nf2 automated match to d1shux_ complexed with act, mg |
PDB Entry: 3n2n (more details), 1.8 Å
SCOPe Domain Sequences for d3n2nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n2nc1 c.62.1.1 (C:38-220) automated matches {Human (Homo sapiens) [TaxId: 9606]} acyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmklte dreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhedl ffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsilk ksc
Timeline for d3n2nc1: